Drug Designing: Open Access

Drug Designing: Open Access
Open Access

ISSN: 2169-0138

Research Article - (2016) Volume 5, Issue 1

Identification of Antigenic Determinants, Solvent Accessibility and MHC Binders of Antigen NADH Dehydrogenase Subunit 5 from a Little Dragon from Medina (Dracunculusmedinensis)

Sonu Mishra* and Virendra S Gomase
Department of Biotechnology, Mewar University, Chittorgarh, India, E-mail: sonumishra1014@gmail.com
*Corresponding Author: Sonu Mishra, Department of Biotechnology, Mewar University, Chittorgarh, India, Tel: 01471 220 881 Email:

Published Date: Jan 01, 1970

Abstract

Dracunculiasis caused by the pathogen Dracunculus medinensis (a little dragon from Medina). The Cyclops is the intermediate host that ingests the larvae of parasite (D. medinensis), that later on ingested by the human from the contaminated stagnant unfiltered water from the water source. After an incubation period of a year these mature female worm comes towards the skin and start formation of a small round bulge on the skin by secreting an irritating chemical which causes severe pain. In this study we will summarize the potency of NADH dehydrogenase subunit 5 (mitochondrion) from Dracunculus medinensis with 527 amino acids. Antigenic peptide of NADHdehydrogenasesubunit5 protein is most suitable for subunit vaccine development because with single epitope, the immune response can be generated in large population. In this research, we used PSSM and SVM algorithms for the prediction of MHC class I and II binding peptide, antigenicity, Solvent accessibility, polar and nonpolar residue to analyse the regions that are likely exposed on the surface of proteins which are potentially antigenic that allows potential drug targets to identify active sites against infection as well as to design effective drug to treat it.

<

Keywords: Dracunculiasis, Antigenic peptides; MHC-Binders; TapPred; PSSM; SVM; Nonamers; NADH; Dehydrogenase subunit 5

Introduction

NADH dehydrogenase 5 (ND5) protein contribute to be a part of the large enzyme complex i.e Complex I, which is active in mitochondria. Complex I is an one of the essential enzyme complexes necessary for oxidative phosphorylation and thereafter, mitochondrial enzyme complexes execute chemical reactions that contribute to the ATP production. Complex I is responsible for the first step in the electron transport process. The NADH dehydrogenase complex (or mitochondrial respiratory complex I) plays an important role in the oxidation of NADH by ubiquinone by catalysis. This chemical reaction is linked to proton transfer across mitochondrial membranes. Study reveals that there are multiple humans disorders are consociated with mutations of the mitochondrial ND genes [1]. Mutations in mitochondrial DNA of ND5 have been found to be the most important cause of several disorder like hypertrophic cardiomyopathy(homoplasmic ND5 12338T>C variant) [2], Leber’s hereditary optic neuropathy (LHON) which is a maternally inherited eye disease(homoplasmic ND4 G11696A and ND5 T12338C mutation) [3], Light syndrome(ND5*13513 G to A mutation) [4], Leber’s hereditary optic neuropathy is associated with the T12338C mutation in mitochondrial ND5 gene in six Han Chinese families [5]. The heteroplasmic T>C transition at position 13271 in MTND5 affects a highly conserved base and segregates with the disease. Investigation suggest that, this is the 15th mutation affecting the MTND5 subunit of respiratory chain complex I and affirms its importance site for disease with phenotypes ranging from MELAS and infantile encephalopathies to isolated syndromes affecting a single tissue such as Leber hereditary optic neuropathy and now skeletal muscle [6]. Looking at its important we have used this protein to study the antigenicity of protein, its solvent accessibility, polar and nonpolar residue to analyse the regions that are likely exposed on the surface of proteins which could be the potentially antigenic that allows potential drug targets to identify active sites against infection as well as to design effective drug to treat Dracunculiasis. D.medinesis (a little dragon from Medina) is the causative agent and it is the only species from the 12 species of Dracunculus [7-10] which infects humans, commonly known as “Guinea Worm Disease (GWD)”. The other Dracunculus species generally resides in the internal tissues and body cavities of non-human mammals and reptiles (snake and turtles) [11]. This little dragon undergo a very unusual life cycle of six developmental stages with incubation period last for 1 to one an half years approximately (Figure 1) [12]. This is one of the most neglected tropicalparasites which bears clinical importance and needs to be eradicated after small pox [13]. After reaching to the maturation stage, these worms copulate and an adult female produces millions of eggs in its uterus whereas male dies. Later on, the female worm release the larvae which induces a painful blister (1-6 cm diameter ) on the skin of lower limbs (predominantly localized in the lower extremities(80-90%) in most of the reported cases) (Figure 1a). The infected person develops slight fever, local skin redness, swelling and severe pruritus around the blister. Other symptoms include: diarrhea, nausea, vomiting and dizziness. The blister burst within three days and female worms one or more slowly comes out from the wounds which causes an excoriating burning sensation and pain [14] (Figure 1b). Immersing or pouring water over the blister provides pain reliever. But this the moment that adult female is exposed to the external environment [15] During emergence of the limbs in open water sources it recognizes the temperature difference and releases the milky white liquid in the water which contains millions of immature larvae, when larvae released in water are ingested by copepods where they mount twice and become infective larvae within two weeks [16].

drug-designing-Guinea-worm

Figure 1: Guinea worm life cycle and interventions to interrupt transmission.

drug-designing-lower-limbs

Figure 1a: A Blister (1-6cm diameter) on the skin of lower limbs.

drug-designing-blister-burst

Figure 1b: The worm coming out after blister burst.

The D. medinensis antigen peptides can be most desirable segment for the subunit vaccine development because with the single epitope, the immune response can be generated in large population. This approach is usually based on the phenomenon of cross-protection, whereby infected with the mild strain and is protected against a more severe strain of the same. The phenotype of the resistant transgenic hosts includes fewer centers of initial infection, a delay in symptom development and low accumulation. The World Health Assembly called in the 1986 in order to dracunculiasis elimination. The global Guinea Worm Eradication Program, supported by The Carter Center, World Health Organization (WHO), UNICEF, CDC, and other partners, began assisting ministries of health of countries in which dracunculiasis is endemic in meeting this goal. At that time, an estimated 3.5 million cases occurred each year in 20 countries in Africa and Asia. Dracunculiasis remains endemic in four countries in 2014 (South Sudan, Chad, Mali, and Ethiopia), but the number of overall reported incidence is decreases in 2013 by 73% and in 2014 by 71% compared with 2012. Failures in surveillance and containment, lack of clean drinking water, insecurity in Mali and parts of South Sudan, and an unusual epidemiologic pattern in Chad are the main remaining challenges to dracunculiasis eradication [17]. A case of Onchocerca volvulus has been reported in the Cameroon which is mimicking Dracunculus medinensis [18]. More than two decades after the International Drinking Water Supply and Sanitation Decade (IDWSSD) implemented by the United Nations (1981-1990) [19], the disease still lingers, underscoring the daunting challenge of disease control, as has been the case of the failure of previous attempts to eradicate diseases like malaria, hookworm and yaws [20]. Till date there is no accurate and efficient curative drug of vaccine is available against dracunculiasis [21]. The investigation suggests that the immunity is not developed by the infected individual [22]. Dracunculus medinensis –specific antibodies (total, IgG1 and IgG4) during the time of patency, which were significantly higher than the levels measured in the same individuals eight months later, except for a few individuals who had developed a new patent infection [23]. It was observed that the mean level of specific IgG1 and IgG4 is higher during the month of potency of the infected individual whereas variation in the IgE value is relatively negotiable and constant before, during the infection and after the recovery. There is possibility that variation in antibody production is regulated by infected larvae (i.e by transmission ) and / or by adult worms (i.e by patency) is still need to be clear out. It is possibility that increased production of IgG1,IgG4 during the time of patency plays a role in blockingor protecting immune responses otherwise it could have killed ingested infected larvae [24]. The D. medinensis antigen peptides can be most desirable segment for the subunit vaccine development because with the single epitope, the immune response can be generated in large population. This approach is usually based on the phenomenon of cross-protection, whereby infected with the mild strain and is protected against a more severe strain of the same. The resistant transgenic host’s phenotype includes of fewer centers of initial infection, following a delay development in symptom with low accumulation. Antigenic peptides from D. medinens is most suitable for the development of peptide vaccine [25] because a single protein subunit can generate sufficient immune response. In this research work we have used the phenomenon of cross-protection, whereby an individual undertaken by a mild toxin can have immunity to survive against similar strong toxic effects. MHC molecules are cell surface protein that binds to the peptides derived from host or antigenic proteins and present them to cell surface for recognition by T-cells. T cell recognition is an important mechanism of the adaptive immune system by which the host identifies and responds to foreign antigens [25,26]. There are two types of MHC molecule and are extremely polymorphic. MHC class I molecules present peptides from proteins synthesized within the cell, whereas, MHC class II molecule present peptides derived from endocytosed extracellular proteins. MHC molecules have been well characterized due to their role in immune reactions and they take active part in host immune reactions and involvement of MHC class molecule in response to almost all antigens and it give impacts on specific sites. The involvement of MHC class-I molecule in response to almost all antigens make the study very interesting. They bind to some of the peptide fragments generated after proteolytic cleavage of antigen [27]. Identification of MHC-binding peptides and T-cell epitopes helps improve our understanding of specificity of immune responses [28]. Antigenic peptides are most suitable for peptide vaccine development because single epitope can generate large the immune response [29].

Methodology

Database searching

The antigenic protein sequence of NADH dehydrogenase subunit5 from Dracunculus medinensis was retrieved from www.ncbi.nlm.nih. gov, UniProt databases are initially the most important [30-32].

Prediction of antigenicity

Prediction of antigenicity program predicts those segments from Antigen NADHdehydrogenasesubunit5 protein that are likely to be antigenic by eliciting an antibody response. In this research work antigenic epitopes of Dracunculus medinensis antigen NADHdehydrogenasesubunit5 are determined by using the Hopp and Woods, Welling, Parker, Bepipred ,Kolaskar and Tongaonkar antigenicity methods [33-38].

Prediction of MHC binding peptide

The major histocompatibility complex (MHC) peptide binding of Dracunculus medinensisis predicted using neural networks trained on C terminals of known epitopes. Rankpep predicts peptide binders to MHC-I ligands whose C-terminal end is likely to be the result of proteosomal cleavage using Position Specific Scoring Matrices (PSSMs). Peptides that bind to a given MHC molecule share sequence similarity. Traditionally, the sequence patterns used for the prediction of peptides binding to MHC molecules. Such sequence patterns, however, have proven to be too simple, as the complexity of the binding motif cannot be precisely represented by the few residues present in the pattern [39]. RANKPEP uses “Position Specific Scoring Matrices (PSSMs) or profiles” from set of aligned peptides known to bind to a given MHC molecule as the predictor of MHC-peptide binding and overcome the complexity of the binding motif limitation. RANKPEP web server is a variability masking feature to focus on the prediction of conserved epitopes, which could thus help to avoid immune evasion resulting from mutation. Support Vector Machine (SVM) based method for prediction of promiscuous MHC class II binding peptides from protein sequence; SVM has been trained on the binary input of single amino acid sequence [40-43].

Prediction of antigenic peptides by Cascade SVM based TAPPred method

In the present study, we predict cascade SVM based several TAP binders which was based on the sequence and the features of amino acids [44]. We found the MHCI binding regions (Table 1), the binding affinity of Dracunculus medinensis.

MHC-I Allele RANK POS. N SEQUENCE C MW (Da) SCORE % OPT.
8mer_H2_Db 1 262 STL SQIGFCFF GLG 930.1 20.659 39.35%
8mer_H2_Db 7 63 GSV VVYSGFYM MED 947.12 13.569 25.85%
8mer_H2_Db 8 306 LCG GQQDSRGY VGV 891.9 12.539 23.89%
8mer_H2_Db 9 512 FSG KEINFLFL CLF 1005.23 12.34 23.51%
8mer_H2_Db 10 419 LWW LNYNSFVI SSS 951.09 12.251 23.34%
9mer_H2_Db 1 418 FLW WLNYNSFVI SSS 1114.3 22.359 44.39%
9mer_H2_Db 2 71 FYM MEDYNFNYF CVV 1224.32 20.942 41.58%
9mer_H2_Db 3 95 GVV FSNNCISML IFW 1010.19 19.364 38.45%
9mer_H2_Db 4 332 VSL MCLCGLFFL GGS 1028.36 18.362 36.46%
9mer_H2_Db 6 101 NCI SMLIFWDLL GVS 1096.39 16.749 33.26%
10mer_H2_Db 1 179 FTK SAQYP FSSWL PKA 1144.3 29.252 49.70%
10mer_H2_Db 4 109 WDL LGVSSYFLVL YYG 1079.31 12.086 20.53%
10mer_H2_Db 6 305 HLC GGQQDSRGYV GVG 1048.08 9.329 15.85%
10mer_H2_Db 8 395 LFY SGGSLVFSFV SLV 981.12 8.591 14.60%
10mer_H2_Db 9 433 LLY SDYYSLFYLF ILG 1299.47 8.398 14.27%
11mer_H2_Db 3 263 TLS QIGFCFFGLGL GLV 1183.44 16.546 20.81%
11mer_H2_Db 5 61 VVG SVVVYSGFYMM EDY 1264.52 15.559 19.57%
11mer_H2_Db 6 368 LFF FSILLTYLYCY RLM 1380.68 13.326 16.76%
11mer_H2_Db 7 261 LST LSQIGFCFFGL GLG 1213.47 12.853 16.17%
11mer_H2_Db 8 93 MVG VVFSNNCISML IFW 1208.45 12.594 15.84%

Table 1: Promiscuous MHC ligands, having C-terminal ends are proteosomal cleavage sites of Dracunculus medinensis. The antigenic peptide to the MHC-1 Allele i.e. 8mer_H2_Db(The binding thresholds:33.04, optimal score:52.494), 9mer_H2_Db(Optimal Score: 50.365, Binding Threshold: 17.96), 10mer_H2_Db(The Optimal Score: 58.858, BindingThreshold: 41.32),11mer_H2_Db(Optimal Score: 79.495, Binding Threshold: 56.96). (All rows highlighted in red represent predicted binders and A peptide highlighted in violet has a C-teminus predicted by the cleavage model used).

Solvent accessible regions

We also analyzed the solvent accessible regions of proteins having highest probability that a given protein region lies on the surface of a protein Surface Accessibility, backbone or chain flexibility by Emini et al. [45] and Karplus and Schulz [46]. By using different scale we predict the hydrophobic and hydrophilic characteristics of amino acids that are rich in charged and polar residues [47-56].

Results

The Dracunculus medinensis Antigen NADH dehydrogenase subunit 5, contain a long residue of 527 amino acids with 483 nonamers.

MDVYIYWFGVILLCFLLLFVFFYDDFVFSLDFSSLELLQFQFRLDWFSFSFFCLLVMVVGSVVVYSGFYM

MEDYNFNYFCVVLSIFVFSMVGVVFSNNCISMLIFWDLLGVSSYFLVLYYGNWDSCSGSMNTVMMNRVGDVCVFLVFCGLFFMGIDFISLELVVSVALFFFILSTFTKSAQYPFSSWLPKAMSAP

TPVSALVHSSTLVTAGLFLGMCFSEVMFLDFVLDFMFFVGLFTMFSSGLMAYFEFDIKKLVALSTLSQIGFCFFGLGLGLVYFSFIHMLSHAVFKSCLFMQMGYIIHLCGGQQDSRGYVGVGGLS SVVYIQTFVSLMCLCGLFFLGGSVSKEILLEHYFFCNWSLFLVFLFFFSILLTYLYCYRLMKGFYYYCSSSLFYSGGSLVFSFVSLVLVVFSIVFLWWLN

YNSFVISSSLLYSDYYSLFYLFILGLVLCVVFFKFGSFDVKYKFYGDLLPKVIIRGNYVVKWSDCMVDYSIMKFGDFSFYVSKIFVMGFSGKEINFLFLCLFLLLMI

Prediction of antigenic peptides

In this study, we found the antigenic determinants by finding the area of greatest local hydrophilicity. The Hopp-Woods scale Hydrophilicity Prediction Result Data found high in position between300-320 in a protein, assuming that the antigenic determinants would be exposed on the surface of the protein and thus would be located in hydrophilic regions (Figure 2). Welling antigenicity plot gives value as the log of the quotient between percentage in a sample of known antigenic regions and percentage in average proteins and Prediction Result Data found high in position 250-270 (Figure 3). We also study Hydrophobicity plot of HPLC / Parker Hydrophilicity Prediction Result Data found between 300-320 (Maximum Score-6.3) i.e., the maximum predicted residues at the position 308(Residue is Q) is 305- GGQQDSR -311and 309 (Residue D) is 306- GQQDSRG-312 (Figure 4), BepiPred predicts the location of linear B-cell epitopes Result found that between 300-310 is 301-MQMGYIIHLC-310 and the maximum score (1.369) is found at the position 308,309 (Figure 5), Kolaskar and Tongaonkar antigenicity methods (Figure 6) Predicted peptides result found i.e.,

drug-designing-Hopp-Woods

Figure 2: Hydrophobicity plot of Hopp and Woods.

drug-designing-plot-Welling

Figure 3: Hydrophobicity plot of Welling et al.

drug-designing-plot-HPLC

Figure 4: Hydrophobicity plot of HPLC/Parker et al.

drug-designing-linear-epitope

Figure 5: Bepipred linear epitope prediction plot.

drug-designing-Kolaskar-Tongaonkar

Figure 6: Kolaskar and Tongaonkar antigenicity plot.

drug-designing-antigenic-propensity

Figure 6a: Kolaskar and Tongaonkar antigenicity plot, the average antigenic propensity for protein is 1.0938.

4-YIYWFGVILLCFLLLFVFFYDDFVFSLDFSSLELLQFQFRLDWFSFSFFCLLVMVVGSVVVYS- 66

76-FNYFCVVLSIFVFSMVGVVFSN-97

99-CISMLIFWDLLGVSSYFLVLY-119

138-VGDVCVFLVFCGLFF-152

156-DFISLELVVSVALFFFILST-175

178-KSAQYPFSSWLPKA-191

193-SAPTPVSALVHSSTLVTAGLFLGMCFSEVMFLDFVLDFMFFVGLFT- 238

251-DIKKLVALSTLSQIGFCFFGLGLGLVYFSFIHMLSHAVFKSCLFM- 295

297-MGYIIHLCGG-306

310-SRGYVGVGGLSSVVYIQTFVSLMCLCGLFFLGG-342

344-VSKEILLEHYFFCNWSLFLVFLFFFSILLTYLYCYRLMKGFYYYCSSSLFYSGGSLVFSFVSLVLVVFSIVFLW- 417

421-YNSFVISSSLLYSDYYSLFYLFILGLVLCVVFFK-454

456-GSFDVKYKFYGDLLPKVIIRGNYVVKWSDCMVDYSI-491

496-DFSFYVSKIFVM-507

514-INFLFLCLFL-523 and the predicted antigenic fragments can bind to MHC molecule is the first bottlenecks in vaccine design.

Solvent accessible regions

We also predict solvent accessible regions in proteins; different measurement was performed for the prediction of antigenic activity, surface region of peptides. Emini et al. (Figure 7) predicts the highest probability i.e. found306-GQQDSR-311(maximum score 7.194), 307-QQDSRG-312(maximum score 7.194),308- QDSRGY- 313(score-6.508),432- YSDYYS-437(6.379),178- KSAQYP-183(score 6.281), that a given protein region lies on the surface of a protein and are used to identify antigenic determinants on the surface of proteins. Karplus and Schulz (Figure 8) High score is found i.e. found 1.122 maximum in 305- GGQQDSR-311. Predict backbone or chain flexibility on the basis of the known temperature B factors of the a-carbons. The hydrophobicity and hydrophilic characteristics of amino acids is determined by using different scales that are rich in charged and polar residues i.e. Sweet et al. hydrophobicity prediction Result Data found high in position 350-370 (Figure 9), Kyte and Doolittle result high in position 10-20 (Figure 10), Abraham and Leo result high in position 350-370(Figure 11), Bull and Breese result high in position 300-320 (Figure 12), Miyazawa result high in position 350-370 (Figure 13),Guy result high in position 300-320 (Figure 14), Wolfenden result high in position 440-460 (Figure 15), Roseman result high in position 350-380 (Figure 16),Wilson et 350-380 (Figure 17), Cowan 350-380 (Figure 18), Chothia 400-430 (Figure 19).

drug-designing-Emini-surface

Figure 7: Emini surface accessibility prediction plot.

drug-designing-Karplus-Schulz

Figure 8: Karplus and Schulz flexibility prediction.

drug-designing-plot-Sweet

Figure 9: Hydrophobicity plot of Sweet et al.

drug-designing-Kyte-Doolittle

Figure 10: Kyte and Doolittle hydrophobicity plot.

drug-designing-Abraham-Leo

Figure 11: Abraham and Leo hydrophobicity plot.

drug-designing-Bull-Breese

Figure 12: Bull and Breese use surface tension to measure hydrophobicity and also uses negative values to describe the hydrophobicity of antigen NADH dehydrogenase subunit 5.

drug-designing-plot-Miyazawa

Figure 13: Hydrophobicity plot of Miyazawa et al.

drug-designing-plot-Guy

Figure 14: Hydrophobicity plot of Guy.

drug-designing-plot-Wolfenden

Figure 15: Hydrophobicity plot of Wolfenden et al.

drug-designing-plot-Roseman

Figure 16: Hydrophobicity plot of Roseman.

drug-designing-HPLC-plot

Figure 17: Hydrophobicity/HPLC plot of Wilson.

drug-designing-Hydrophobicity

Figure 18: Hydrophobicity/HPLC pH 3.4/ plot of Cowan.

drug-designing-plot-Chothia

Figure 19: Hydrophobicity plot of Chothia.

Prediction of MHC binding peptide

We found the binding of peptides to a number of different alleles using Position Specific Scoring Matrix. NADH dehydrogenase subunit 5 of Dracunculus medinensis antigen, with sequence 527 amino acid residues long, is having 519 nonamers. MHC molecules are cell surface proteins, which actively participate in host immune reactions and involvement of MHC-I and MHC-II in response to almost all antigens. We have predicted MHC-I peptide binders of NADH dehydrogenase subunit 5 from Dracunculus medinensis was tested with on a set of 4 different alleles i.e. H2-Db (mouse) 8mer, H2-Db (mouse) 9mer, H2- Db (mouse) 10mer and H2-Db (mouse) 11mer (Table 2) and MHC-II peptide binders for I_Ab.p, I_Ad.p,I_Ag7.p alleles highlighted in red represent predicted binders (Table 3). Here RANKPEP report PSSMspecific binding threshold and is obtained by scoring all the antigenic peptide sequences included in the alignment from which a profile is derived, and is defined as the score value that includes 85% of the peptides within the set. Peptides whose score is above the binding threshold will appear highlighted in red and peptides produced by the cleavage prediction model are highlighted in violet. We also use a cascade SVM based TAPPred method which found 80 High affinity TAP Transporter peptide regions which represents predicted TAP binders residues which occur at N and C termini from Dracunculus medinensis (NADHdehydrogenasesubunit5) (Table 3).

Allele RANK POS. N SEQUENCE C MW (Da) SCORE % OPT.
MHC-II I_Ab 1 385 KGF YYYCSSSLF YSG 1114.26 12.219 34.29%
MHC-II I_Ab 2 484 KWS DCMVDYSIM KFG 1058.25 12.095 33.94%
MHC-II I_Ab 3 384 MKG FYYYCSSSL FYS 1114.26 11.744 32.96%
MHC-II I_Ab 4 324 SVV YIQTFVSLM CLC 1083.31 11.388 31.96%
MHC-II I_Ab 5 192 PKA MSAPTPVSA LVH 841.98 11.24 31.54%
MHC-II I_Ad 1 89 FVF SMVGVVFSN NCI 921.07 16.144 30.38%
MHC-II I_Ad 2 282 SFI HMLSHAVFK SCL 1051.27 11.598 21.82%
MHC-II I_Ad 3 77 YNF NYFCVVLSI FVF 1039.26 7.574 14.25%
MHC-II I_Ad 4 387 FYY YCSSSLFYS GGS 1038.16 7.329 13.79%
MHC-II I_Ag7 1 332 VSL MCLCGLFFL GGS 1028.36 10.512 25.72%
MHC-II I_Ag7 2 33 LDF SSLELLQFQ FRL 1046.2 9.939 24.32%
MHC-II I_Ag7 3 373 ILL TYLYCYRLM KGF 1207.48 9.4 23.00%
MHC-II I_Ag7 4 457 KFG SFDVKYKFY GDL 1178.36 9.342 22.86%
MHC-II I_Ag7 5 71 FYM MEDYNFNYF CVV 1224.32 8.271 20.24%

Table 2: Prediction of MHCII ligands all rows highlighted in red represent predicted binders to the MHC-II Allele i.e. MHC-II I_Ab, MHC-II I_Ad,MHC-II I_Ag7.(All rows highlighted in red represent predicted binders).

Peptide Rank Start Position Sequence Score Predicted Affinity
1 489 YSIMKFGDF 8.651 High
2 483 SDCMVDYSI 8.648 High
3 161 ELVVSVALF 8.643 High
4 96 SNNCISMLI 8.64 High
5 337 LFFLGGSVS 8.639 High
6 305 GGQQDSRGY 8.636 High
7 262 SQIGFCFFG 8.626 High
8 502 SKIFVMGFS 8.62 High
9 417 WWLNYNSFV 8.616 High
10 217 CFSEVMFLD 8.613 High

Table 3: Cascade SVM based high affinity tap binders of Dracunculus medinensis.

Discussion

In this study, we found the antigenic determinants by finding the area of greatest local hydrophilicity. Hopp and Woods hydrophobicity scale is used to identify of potentially antigenic sites in proteins by analyzing amino acid sequences in order to find the point of greatest hydrophilic. Hydrophilicity Prediction result data found high in sequence position at 300-320 in a protein this scale is basically a hydrophilic index where apolar residues have been assigned negative values. The Window size of 5-7 is good for finding hydrophilic regions, greater than 0 values are consider as hydrophilic which is consider as antigenic. Welling used information on the relative occurrence of amino acids in antigenic regions to make a scale which is useful for prediction of antigenic regions and the predicted result data found high in sequence position 250-270. Welling antigenicity plot gives value as the log of the quotient between percentage in a sample of known antigenic regions and percentage in average proteins. We also study Hydrophobicity plot of HPLC / Parker Hydrophilicity Prediction Result Data found between 300-320 (Maximum Score-6.3) i.e., the maximum predicted residues at the position 308(Residue is Q) is 305- GGQQDSR -311 and 309(Residue D) is 306- GQQDSRG-312. BepiPred predicts the location of linear B-cell epitopes Result found that between 300-310 is 301-MQMGYIIHLC-310 and the maximum score (1.369) is found at the position 308,309. There are 15 antigenic determinant sequences is found by Kolaskar and Tongaonkar antigenicity scales (Figures 6a and Table 4) the results show highest pick at position.

Start Position   Sequence End Position
1 4 YIYWFGVILLCFLLLFVFFYDDFVFSLDFS SLELLQFQFRLDWFSFSFFCLLVMVVGS VVVYS 66
2 76 FNYFCVVLSIFVFSMVGVVFSN 97
3 99 CISMLIFWDLLGVSSYFLVLY 119
4 138 VGDVCVFLVFCGLFF 152
5 156 DFISLELVVSVALFFFILST 175
6 178 KSAQYPFSSWLPKA 191
7 193 SAPTPVSALVHSSTLVTAGLFLGMCFSE VM FLDFVLDFM FFVGLFT 238
8 251 DIKKLVALSTLSQIGFCFFGLGLGLVYFSF IHMLSHAVFKSCLFM 295
9 297 MGYIIHLCGG 306
10 310 SRGYVGVGGLSSWYIQTFVSLMCLCGL FFLGG 342
11 344 VSKEILLEHYFFCNWSLFLVFLFFFSILLT YLYCYRLMKGFYYYCSSSLFYSGGSLV FSFVSLVLVVFSIVFLW 417
12 421 YNSFVISSSLLYSDYYSLFYLFILGLVLCV VFFK 454
13 456 GSFDVKYKFYGDLLPKVIIRGNYVVKWS DCMVDYSI 491
14 496 DFSFYVSKIFVM 507
15 514 INFLFLCLFL 523

Table 4: The 15antigenic determinants of NADH dehydrogenasesubunit5.

4-YIYWFGVILLCFLLLFVFFYDDFVFSLDFSSLELLQFQFRLDWFSFSFFCLLVMVVGSVVVYS- 66, 76- FNYFCVVLSIFVFSMVGVVFSN- 97, 99-CISMLIFWDLLGVSSYFLVLY-119, 138-VGDVCVFLVFCGLFF- 152,156-DFISLELVVSVALFFFILST-175,178- KSAQYPFSSWLPKA-191,193-SAPTPVSALVHSSTLVTAGLFLGMCFSEVMFLDFVLDFMFFVGLFT- 238,251-DIKKLVALSTLSQIGFCFFGLGLGLVYFSFIHMLSHAVFKSCLFM- 295,297-MGYIIHLCGG- 306,310-SRGYVGVGGLSSVVYIQTFVSLMCLCGLFFLGG-342,344- SKEILLEHYFFCNWSLFLVFLFFFSILLTYLYCYRLMKGFYYYCSSSLFYSGGSLVFSFVSLVLVVFSIVFLW- 417,421-YNSFVISSSLLYSDYYSLFYLFILGLVLCVVFFK- 454,456-GSFDVKYKFYGDLLPKVIIRGNYVVKWSDCMVDYSI- 491, 496-DFSFYVSKIFVM-507, 514-INFLFLCLFL- 523.

Result of determined antigenic sites on proteins has revealed that the hydrophobic residues if they occur on the surface of a protein are more likely to be a part of antigenic sites. This method can predict antigenic determinants with about 75% accuracy and also gives the information of surface accessibility and flexibility. Further this region form beta sheet which show high antigenic response than helical region of this peptide and shows highly antigenicity. The Structure of the Dracunculus medinensis antigen-NADHdehydrogenasesubunit5 is predicted by SWISS-MODEL (automated protein structure homologymodelling server) DeepView (Swiss Pdb-Viewer) program (Figure 20). The purpose of this server is to make Protein Modelling accessible to all biochemists and molecular biologists worldwide. The target structure will also serve as a detailed model for determining the structure of peptide within that protein structure. We predict Solvent accessibility by using Emini et al. the result found the highest probability i.e. found 306-GQQDSR-311(maximum score 7.194), 307-QQDSRG- 312(maximum score 7.194), 308- QDSRGY-313(score-6.508),432- YSDYYS-437(6.379),178- KSAQYP-183(score 6.281), that a given protein region lies on the surface of a protein and are used to identify antigenic determinants on the surface of proteins. This algorithm also used to identify the antigenic determinants on the surface of proteins and Karplus and Schulz predict backbone or chain flexibility on the basis of the known temperature B factors of the a-carbons here we found the result with High score 1.122 maximum in 305- GGQQDSR-311. We predict Solvent accessibility of Dracunculus medinensis antigen NADH dehydrogenase subunit 5 for delineating hydrophobic and hydrophilic characteristics of amino acids. Solvent accessibility used to identify active site of functionally important residues in membrane proteins. Solvent-accessible surface areas and backbone angles are continuously varying because proteins can move freely in a three-dimensional space. The mobility of protein segments which are located on the surface of a protein due to an entropic energy potential and which seem to correlate well with known antigenic determinants. We also found the i.e. Sweet et al. hydrophobicity prediction result data found high in position 350-370, Kyte and Doolittle result high in position 10-20, Abraham and Leo result high in position 350-370, Bull and Breese result high in position 300-320, Guy result high in position 300-320, Miyazawa result high in position 350-370, Roseman result high in position 350-380,Wolfenden result high in position 440-460,Wilson et 350-380, Cowan 350-380,Chothia 400-430. These scales are a hydrophilic with a polar residues assigned negative value. Because the N- and C- terminal regions of proteins are usually solvent accessible and unstructured, antibodies against those regions recognize the antigenic protein. In this study, we found predicted MHC-I peptide binders of toxin protein for 8mer_H2_Db alleles with the consensus sequence QNWNCCTI that yields the maximum score i.e. 52.494, 9mer_H2_Db with, the consensus sequence FCIHNCDYM that yields the maximum score i.e. 50.365, 10mer_H2_Db with, the consensus sequence SGYYNFFWCL that yields the maximum score i.e. 58.858, 11mer_H2_Db with, the consensus sequence CGVYNFYYCCY that yields the maximum score i.e. 79.495 and I_Abwith the consensus sequence YYAPWCNNA that yields the maximum score i.e. 35.632,I_Ad with the consensus sequence QMVHAAHAE that yields the maximum score i.e. 53.145, MHC-II I_Ag7 with the consensus sequence WYAHAFKYV that yields the maximum score i.e. 40.873 for MHC II allele was tasted. We also use a cascade SVM based TAPPred method which found 160 High affinity TAP Transporter peptide regions which represents predicted TAP binders residues which occur at N and C termini from Dracunculus medinensis antigen NADHdehydrogenasesubunit5. TAP is an important transporter that transports antigenic peptides from cytosol to ER. TAP binds and translocate selective antigenic peptides for binding to specific MHC molecules. The efficiency of TAP-mediated translocation of antigenic peptides is directly proportional to its TAP binding affinity. Thus, by understanding the nature of peptides, that bind to TAP with high affinity, is important steps in endogenous antigen processing. The correlation coefficient of 0.88 was obtained by using jackknife validation test. In this test, we found the MHCI and MHCII binding regions. T cell immune responses are derived by antigenic epitopes hence their identification is important for design synthetic peptide vaccine. T cell epitopes are recognized by MHCI molecules producing a strong defensive immune response against antigen NADHdehydrogenasesubunit5. Therefore, the prediction of peptide binding to MHCI molecules by appropriate processing of antigen peptides occurs by their binding to the relevant MHC molecules. Because, the C-terminus of MHCI-restricted epitopes results from cleavage by the proteasome and thus, proteasome specifity is important for determing T-cell epitopes. Consequently, RANKPEP also focus on the prediction of conserved epitopes. C-terminus of MHCI-restricted peptides is generated by the proteasome, and thus RANKPEP also determines whether the C-terminus of the predicted MHCI-peptide binders is the result of proteasomal cleavage. Moreover, these sequences are highlighted in purple in the output results. Proteasomal cleavage predictions are carried out using three optional models obtained applying statistical language models to a set of known epitopes restricted by human MHCI molecules as indicated here.

drug-designing-NADH-dehydrogenase

Figure 20: Structure of NADH dehydrogenase subunit 5 the Dracunculus medinensis antigen (DeepView (Swiss Pdb-Viewer) program).

Conclusion

From the above result and discussion it is concluded that the ability of RANKPEP to predict MHC binding peptides, and thereby potential T-cell epitopes, antigenic peptide that binds to MHC molecule are antigenic that means hydrophilic in nature. This means the increase in affinity of MHC binding peptides may result in enhancement of immunogenicity of Dracunculus medinensis antigen NADH dehydrogenase subunit5 and are helpful in the designing of synthetic peptide vaccine. This approach can help reduce the time and cost of experimentation for determining functional properties of Dracunculus medinensis antigen NADHdehydrogenasesubunit5. Overall, the results are encouraging, both the ‘sites of action’ and ‘physiological functions’ can be predicted with very high accuracies helping minimize the number of validation experiments.

References

  1. Wallace DC (1992) Diseases of the mitochondrial DNA. Annu Rev Biochem 61: 1175-1212.
  2. Liu Z, Song Y, Gu S, He X, Zhu X, et al.(2012). Mitochondrial ND5 12338T>C variant is associated with maternally inherited hypertrophic cardiomyopathy in a Chinese pedigree. Gene506 :339-43.
  3. Ji YC, Liu XL, Zhao FX, Zhang JJ, Zhang Y, et al.(2011). The mitochondrial ND5 T12338C mutation may be associated with Leber's hereditary optic neuropathy in two Chinese families. 33:322-328.
  4. Wang K, Yan CZ, Wang GX, Jiao JS, Jin M (2010) Mitochondrial ND5 as the causative gene of Leight syndrome. 27: 616-619.
  5. Liu XL, Zhou X, Zhou J, Zhao F, Zhang J, et al. (2011) Leber's hereditary optic neuropathy is associated with the T12338C mutation in mitochondrial ND5 gene in six Han Chinese families. Ophthalmology 118: 978-985.
  6. Downham E, Winterthun S, Nakkestad HL, Hirth A, Halvorsen T, et al. (2008) A novel mitochondrial ND5 (MTND5) gene mutation giving isolated exercise intolerance. NeuromusculDisord 18: 310-314.
  7. Muller R (1971) Dracunculus and dracunculiasis. AdvParasitol 9: 73-151.
  8. Muller R (1979) Guinea worm disease: epidemiology, control, and treatment. Bull World Health Organ 57: 683-689.
  9. Jones HI, Mulder E (2007) Dracunculusmulbus n. sp. (Nematoda: Spirurida) from the water python Liasisfuscus (Serpentes: Boidae) in northern Australia. SystParasitol 66: 195-205.
  10. Moravec F, Santos CP (2009) Dracunculusbrasiliensis sp. n. (Nematoda: Dracunculidae) from the anaconda, Eunectesmurinus (Ophidia: Boidae). Parasitol Res 104: 589-592.
  11. Birare SD, Kamble MH, Lanjewar DN, Parija SC, Girji DD, et al. (2005) Guinea worm infection of urinary bladder manifesting as obstructive uropathy in rural Maharashtra. Trop Doct 35: 242.
  12. Greenaway C (2004).Dracunculiasis (Guinea worm disease). CMAJ 170: 495-500.
  13. Müllner A, Helfer A, Kotlyar D, Oswald J, Efferth T (2011) Chemistry and pharmacology of neglected helminthic diseases. Curr Med Chem 18: 767-789.
  14. Ruiz-Tiben E, Hopkins DR (2006) Dracunculiasis (Guinea worm disease) eradication. AdvParasitol 61: 275-309.
  15. Iriemenam NC, Oyibo WA, Fagbenro-Beyioku AF (2008) Dracunculiasis--the saddle is virtually ended. Parasitol Res 102: 343-347.
  16. Hopkins DR, Ruiz-Tiben E, Eberhard ML, Roy SL; Centers for Disease Control and Prevention (CDC) (2014) Progress toward global eradication of dracunculiasis--January 2013-June 2014. MMWR Morb Mortal Wkly Rep 63: 1050-1054.
  17. Eta N, Gerald ES, Flaubert D, Walter KK, Valeri O, et al. (2015) Not every worm wrapped around a stick is a guinea worm: a case of Onchocerca volvulus mimicking Dracunculusmedinensis. Parasit Vectors8: 374.
  18. Richards FO, Ruiz-Tiben E, Hopkins DR (2011) Dracunculiasis eradication and the legacy of the smallpox campaign: what's new and innovative? What's old and principled? Vaccine 29 Suppl 4: D86-90.
  19. Muller R (1985) Life cycle of DracunculusMedinesis .In workshop on opportunities for control of dracunculiasis : contaminated papers, washinton,DC:National Academy Press.
  20. Cairncross S, Muller R, Zagaria N (2002) Dracunculiasis (Guinea worm disease) and the eradication initiative. ClinMicrobiol Rev 15: 223-246.
  21. Bloch P, Simonsen PE, Vennervald BJ (1993) The antibody response to Dracunculusmedinensis in an endemic human population of northern Ghana. J Helminthol 67: 37-48.
  22. Bloch P, Simonsen PE (1998) Immunoepidemiology of Dracunculusmedinensis infections II. Variation in antibody responses in relation to transmission season and patency. Am J Trop Med Hyg 59: 985-990.
  23. Flower DR (2008) Vaccines: how they work in Bioinformatics for Vaccinology.Wiley-Blackwell, Oxford, UK. 73-112.
  24. Batalia MA, Collins EJ (1997) Peptide binding by class I and class II MHC molecules. Biopolymers 43: 281-302.
  25. Marrack P1, Scott-Browne JP, Dai S, Gapin L, Kappler JW (2008) Evolutionarily conserved amino acids that control TCR-MHC interaction. Annu Rev Immunol 26: 171-203.
  26. Chapman HA (1998) Endosomal proteolysis and MHC class II function. CurrOpinImmunol 10: 93-102.
  27. Gomase VS, Chitlange NR (2012) Prediction of MHC Class Antigen Peptides from EchinococcusMultilocularis: Application of Computer Intelligence 1: 191.
  28. Sayers EW, Acland A, Agarwala R, Barrett T, Beck J, et al. (2012).Database resources of the National Center for Biotechnology Information. Nucleic Acids Res 40: D13-25.
  29. Bairoch A, Apweiler R, Wu CH, Barker WC, Boeckmann B, et al. (2005) The Universal Protein Resource (UniProt). Nucleic Acids Res 33: D154-159.
  30. Hopp TP, Woods KR (1981) Prediction of protein antigenic determinants from amino acid sequences. ProcNatlAcadSci U S A 78: 3824-3828.
  31. Welling GW, Weijer WJ, van der Zee R, Welling-Wester S (1985) Prediction of sequential antigenic regions in proteins. FEBS Lett 188: 215-218.
  32. Parker KC, Bednarek MA, Coligan JE (1994) Scheme for ranking potential HLA-A2 binding peptides based on independent binding of individual peptide side-chains. J Immunol 152: 163-175.
  33. Larsen JE, Lund O, Nielsen M (2006) Improved method for predicting linear B-cell epitopes. Immunome Res 2: 2.
  34. Kolaskar AS, Tongaonkar PC (1990) A semi-empirical method for prediction of antigenic determinants on protein antigens. FEBS Lett 276: 172-174.
  35. Mishra Sonu and Virendra S Gomase (2015) Prediction of antigenic epitope from D. medinensis: new paradigm of synthetic vaccine development. International Conference on “Recent Research Development in Environment, Social Sciences and Humanities. ICRRDESH, India.
  36. Ruppert J, Sidney J, Celis E, Kubo RT, Grey HM, et al. (1993) Prominent role of secondary anchor residues in peptide binding to HLA-A2.1 molecules. Cell 74: 929-937.
  37. Reche PA, Glutting JP, Reinherz EL (2002) Prediction of MHC class I binding peptides using profile motifs. Hum Immunol 63: 701-709.
  38. Reche PA, Reinherz EL (2003) Sequence variability analysis of human class I and class II MHC molecules: functional and structural correlates of amino acid polymorphisms. J MolBiol 331: 623-641.
  39. Craiu A, AkopianT (1997)Two distinct proteolytic processes in the generation of a major histocompatibility complex class I-presented peptide. ProcNatlAcadSci U S A. 94: 10850-10855.
  40. Pieters J (2000) MHC class II-restricted antigen processing and presentation. AdvImmunol 75: 159-208.
  41. Bhasin M, Raghava GP (2004) Analysis and prediction of affinity of TAP binding peptides using cascade SVM. Protein Sci 13: 596-607
  42. Emini, EA, Hughes JV, Perlow DS, Boger J (1985) Induction of hepatitis a virus-neutralizing antibody by a virus-specific synthetic peptide.J Virol. 55: 836-839.
  43. Karplus PA, Schulz GE (1985) Prediction of chain flexibility in proteins: a tool for the selection of peptide antigen. Naturwissenschaften72: 212-213.
  44. Sweet RM, Eisenberg D (1983) Correlation of sequence hydrophobicities measures similarity in three-dimensional protein structure. J. Mol. Biol 171: 479- 488.
  45. Kyte J, Doolittle RF (1982) A simple method for displaying the hydropathic character of a protein. J MolBiol 157: 105-132.
  46. Abraham DJ, Leo AJ (1987) Extension of the fragment method to calculate amino acid zwitterion and side chain partition coefficients. Proteins 2: 130-152.
  47. Bull HB, Breese K (1974) Surface tension of amino acid solutions: a hydrophobicity scale of the amino acid residues. Arch BiochemBiophys 161: 665-670.
  48. Miyazawa S, Jernigen RL (1985) Estimation of Effective Interresidue Contact Energies from Protein Crystal Structures: Quasi-Chemical Approximation. Macromolecules 18: 534-552.
  49. Roseman MA (1988) Hydrophilicity of polar amino acid side-chains is markedly reduced by flanking peptide bonds. J MolBiol 200: 513-522.
  50. Wolfenden R, Andersson L, Cullis PM, Southgate CC (1981) Affinities of amino acid side chains for solvent water. Biochemistry 20: 849-855.
  51. Wilson KJ, Honegger A, Stötzel RP, Hughes GJ (1981) Thebehaviour of peptides on reverse-phase supports during high-pressure liquid chromatography. Biochem J 199: 31-41.
  52. Cowan R, Whittaker RG (1990) Hydrophobicity indices for amino acid residues as determined by high-performance liquid chromatography. Pept Res 3: 75-80.
  53. Chothia C (1976) The nature of the accessible and buried surfaces in proteins. J MolBiol 105: 1-12.
Citation: Mishra S, Gomase VS (2016) Identification of Antigenic Determinants, Solvent Accessibility and MHC Binders of Antigen NADH Dehydrogenase Subunit 5 from a Little Dragon from Medina (Dracunculus medinensis). Drug Des 5:126.

Copyright: © 2016 Mishra S, et al. This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are credited.
Top